Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPS2 Peptide - C-terminal region

GPS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPS2

UniProt

Q13227

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPS2 Rabbit Polyclonal Antibody (orb588609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cone-rod homeobox protein (CRX)
CSB-EP006004HU-01 20 µg

Recombinant Human Cone-rod homeobox protein (CRX)

Sign In for Pricing
View Details
Recombinant Human Cone-rod homeobox protein (CRX)
CSB-EP006004HU-02 100 µg

Recombinant Human Cone-rod homeobox protein (CRX)

Sign In for Pricing
View Details
Recombinant Human Cone-rod homeobox protein (CRX)
CSB-EP006004HU-03 1 mg

Recombinant Human Cone-rod homeobox protein (CRX)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus entD/SED Protein, C-His
orb2824252-01 20 µg

Recombinant Staphylococcus aureus entD/SED Protein, C-His

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus entD/SED Protein, C-His
orb2824252-02 50 µg

Recombinant Staphylococcus aureus entD/SED Protein, C-His

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus entD/SED Protein, C-His
orb2824252-03 100 µg

Recombinant Staphylococcus aureus entD/SED Protein, C-His

Sign In for Pricing
View Details