BLVRA Peptide - middle region
BLVRA Peptide - middle region
Product Specifications
Product Name Alternative
BVR, BLVR, BVRA
UniProt
P53004
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BLVRA Rabbit Polyclonal Antibody (orb589327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000703.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRY
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2577914 100 µg
Kallikrein 5/KLK5 Rabbit Polyclonal Antibody (FITC)
Sign In for Pricing
View Details 
orb359536 100 µg
4-hydroxyphenylpyruvate dioxygenase Polyclonal Antibody
Sign In for Pricing
View Details 
299642-01 50 L
DKW Medium with Vitamins (Driver and Kuniyuki Walnut Medium, with Vitamins) (Powder) discontinued
Sign In for Pricing
View Details 299642-02 100 L
DKW Medium with Vitamins (Driver and Kuniyuki Walnut Medium, with Vitamins) (Powder) discontinued
Sign In for Pricing
View Details