Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2B Peptide - C-terminal region

ACSM2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HXMA, ACSM2, HYST1046

UniProt

Q68CK6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM2B Rabbit Polyclonal Antibody (orb55806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001098539.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRTKLRDKEWKMSGKAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Drosophila melanogaster (Fruit fly) Hsp70Ba Polyclonal Antibody
MBS9002637 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) Hsp70Ba Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gpbp1 shRNA (UAS) - Lentiviral mouseGpbp1 shRNA (UAS, GFP) (25)
GTR15211712 1 Vial

Lentiviral mouse Gpbp1 shRNA (UAS) - Lentiviral mouseGpbp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
(Z) -9-Propenyladenine 1mg
A21687-1 1 mg

(Z) -9-Propenyladenine 1mg

Sign In for Pricing
View Details
Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb
orb2327072-01 25 µL

Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb
orb2327072-02 50 µL

Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb
orb2327072-03 100 µL

Tyrosine 3-monooxygenase (Ser70) Recombinant Rabbit mAb

Sign In for Pricing
View Details