Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP2 Peptide - C-terminal region

NCBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBC2, NIP1, CBP20, PIG55

UniProt

P52298

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCBP2 Rabbit Polyclonal Antibody (orb589453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001036005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 Rabbit mAb
59081 50 µL

CDK4 Rabbit mAb

Sign In for Pricing
View Details
TOX2 (NM_001098798) Human 3' UTR Clone
SC211283 10 µg

TOX2 (NM_001098798) Human 3' UTR Clone

Sign In for Pricing
View Details
Rabbit Anti-Human CYFIP2 Polyclonal Antibody
PA83376HU-01 50 µg

Rabbit Anti-Human CYFIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CYFIP2 Polyclonal Antibody
PA83376HU-02 100 µg

Rabbit Anti-Human CYFIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CYFIP2 Polyclonal Antibody
PA83376HU-03 500 µg

Rabbit Anti-Human CYFIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CYFIP2 Polyclonal Antibody
PA83376HU-04 1 mg

Rabbit Anti-Human CYFIP2 Polyclonal Antibody

Sign In for Pricing
View Details