Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP2 Peptide - C-terminal region

NCBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBC2, NIP1, CBP20, PIG55

UniProt

P52298

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCBP2 Rabbit Polyclonal Antibody (orb589453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001036005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microtubule-associated protein 1A (MAP1A) Human ELISA Kit
E9960 96 Tests

Microtubule-associated protein 1A (MAP1A) Human ELISA Kit

Sign In for Pricing
View Details
1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride
XZB07612-01 50 mg

1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride

Sign In for Pricing
View Details
1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride
XZB07612-02 0.5 g

1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride

Sign In for Pricing
View Details
KIAA1530 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
25622111 3x 1.0 µg

KIAA1530 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Glutathione Synthetase Polyclonal Antibody, Cy7 Conjugated
bs-11850R-Cy7-TR 20 µL

Glutathione Synthetase Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
pLenti-SELPLG shRNA-3 Plasmid
PVTB00877-3c 2 µg

pLenti-SELPLG shRNA-3 Plasmid

Sign In for Pricing
View Details