Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP2 Peptide - C-terminal region

NCBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBC2, NIP1, CBP20, PIG55

UniProt

P52298

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCBP2 Rabbit Polyclonal Antibody (orb589453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001036005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT1 Blocking Peptide
MBS9620008-01 1 mg

WNT1 Blocking Peptide

Sign In for Pricing
View Details
WNT1 Blocking Peptide
MBS9620008-02 5x 1 mg

WNT1 Blocking Peptide

Sign In for Pricing
View Details
Chicken soluble triggering receptor expresses on myeloid cells-1 (sTREM-1) ELISA Kit
EIA07288Ch 1 Kit

Chicken soluble triggering receptor expresses on myeloid cells-1 (sTREM-1) ELISA Kit

Sign In for Pricing
View Details
Anti-BST-2 antibody
STJ91904 200 µl

Anti-BST-2 antibody

Sign In for Pricing
View Details
CD59 Rabbit Polyclonal Antibody
AF6429 50 µL

CD59 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Vitamin D BP Antibody (VDBP/4481) [CoraFluor 1]
NBP3-14005CL1 0.1 mL

Mouse Monoclonal Vitamin D BP Antibody (VDBP/4481) [CoraFluor 1]

Sign In for Pricing
View Details