SNX3 Peptide - middle region
SNX3 Peptide - middle region
Product Specifications
Product Name Alternative
SDP3, Grd19, MCOPS8
UniProt
O60493
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNX3 Rabbit Polyclonal Antibody (orb589458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001287858.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6250503 1.0 µg DNA
RGD1304952 sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 