Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST2H2AA4 Peptide - N-terminal region

HIST2H2AA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2A/R

UniProt

Q6FI13

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIST2H2AA4 Rabbit Polyclonal Antibody (orb589459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001035807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnlip (NM_013161) Rat Tagged ORF Clone Lentiviral Particle
RR213572L4V 200 µL

Pnlip (NM_013161) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Emcn ORF Vector (Mouse) (pORF)
19247014 1.0 µg DNA

Emcn ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Nck (NCK1) (NM_006153) Human Tagged ORF Clone Lentiviral Particle
RC202869L1V 200 µL

Nck (NCK1) (NM_006153) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)
MBS1126044-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)
MBS1126044-02 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)
MBS1126044-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Succinylglutamate desuccinylase (astE)

Sign In for Pricing
View Details