Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST2H2AA4 Peptide - N-terminal region

HIST2H2AA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2A/R

UniProt

Q6FI13

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIST2H2AA4 Rabbit Polyclonal Antibody (orb589459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001035807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map3k14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4865908 1.0 µg DNA

Map3k14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Dsg1a 3'UTR GFP Stable Cell Line
TU155406 1.0 mL

Dsg1a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Plcb1 AAV siRNA Pooled Vector
36938166 1.0 µg

Plcb1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
VMAT 2 CRISPR Activation Plasmid (m2)
sc-431911-ACT-2 20 µg

VMAT 2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [Alexa Fluor 350]
NBP1-19775AF350 0.1 mL

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
GEN1 (NM_182625) Human Over-expression Lysate
E45H16972-2 20 µg

GEN1 (NM_182625) Human Over-expression Lysate

Sign In for Pricing
View Details