SDE2 Peptide - middle region
SDE2 Peptide - middle region
Product Specifications
Product Name Alternative
C1orf55, dJ671D7.1
UniProt
Q6IQ49
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SDE2 Rabbit Polyclonal Antibody (orb589454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689821.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VD2N274 1 Each
Mouse Anti-Rat Cystatin C (Cys-C) Monoclonal Antibody
Sign In for Pricing
View Details 
A12850-3-APC 100 µg/Vial
Anti-DDX55 Antibody Picoband® APC Conjugated
Sign In for Pricing
View Details 
MBS4380261-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
Topoisomerase II alpha (Proliferation & Drug-Resistance Marker)
Sign In for Pricing
View Details