Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM4 Peptide - N-terminal region

PDLIM4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIL

UniProt

P50479

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM4 Rabbit Polyclonal Antibody (orb589461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001124499.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 Double Nickase Plasmid (bovine2)
sc-437333-NIC-2 20 µg

TLR4 Double Nickase Plasmid (bovine2)

Sign In for Pricing
View Details
HSP60 (GROEL/730), Biotin conjugate, 0.1mg/mL
BNCB0730-500 1x 500 µL

HSP60 (GROEL/730), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCD40L Human, His Active
32-13664-10 10 µg

SCD40L Human, His Active

Sign In for Pricing
View Details
Anti- Human CEACAM-8/CD66b
IT-300-117M2-01 0.1 mg

Anti- Human CEACAM-8/CD66b

Sign In for Pricing
View Details
Anti- Human CEACAM-8/CD66b
IT-300-117M2-02 0.5 mg

Anti- Human CEACAM-8/CD66b

Sign In for Pricing
View Details
SOCS6 Rabbit Polyclonal Antibody
orb2951421-01 50 µg

SOCS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details