Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM4 Peptide - N-terminal region

PDLIM4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIL

UniProt

P50479

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM4 Rabbit Polyclonal Antibody (orb589461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001124499.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recoverin (6A55CD6) AC
sc-53520 AC 500 µg/mL - 25% ag

Recoverin (6A55CD6) AC

Sign In for Pricing
View Details
Human DIAPH3 Pre-designed siRNA Set A
SI004285A 1 Each

Human DIAPH3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ETV4 Antibody
A21353-50UG 50 µg

ETV4 Antibody

Sign In for Pricing
View Details
Human Ribophorin I (RPN1) ELISA Kit
MBS452886-01 48 Tests

Human Ribophorin I (RPN1) ELISA Kit

Sign In for Pricing
View Details
Human Ribophorin I (RPN1) ELISA Kit
MBS452886-02 96 Tests

Human Ribophorin I (RPN1) ELISA Kit

Sign In for Pricing
View Details
Human Ribophorin I (RPN1) ELISA Kit
MBS452886-03 5x 96 Tests

Human Ribophorin I (RPN1) ELISA Kit

Sign In for Pricing
View Details