Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCED1A Peptide - middle region

PCED1A Peptide - middle region

Product Specifications

Product Name Alternative

FAM113A, C20orf81, bA12M19.1

UniProt

Q9H1Q7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCED1A Rabbit Polyclonal Antibody (orb589464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001258097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thap1 Mouse shRNA Lentiviral Particle (Locus ID 73754)
TL512952V 500 µL Each

Thap1 Mouse shRNA Lentiviral Particle (Locus ID 73754)

Sign In for Pricing
View Details
FZD9 Protein Lysate (Human) with C-Ha Tag
21116031 100 µg

FZD9 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Mouse MKK4 / MEK4 / MAP2K4 Protein (His & GST tag)
E53A06420 50 µg

Recombinant Mouse MKK4 / MEK4 / MAP2K4 Protein (His & GST tag)

Sign In for Pricing
View Details
CCL24 Polyclonal Antibody, HRP Conjugated
A54018-050 50 µL

CCL24 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human CDHR2 Pre-designed siRNA Set B
SI002685B 1 Each

Human CDHR2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IFNL1 protein (His tag)
80R-4089 0.1 mg

IFNL1 protein (His tag)

Sign In for Pricing
View Details