Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICU1 Peptide - middle region

MICU1 Peptide - middle region

Product Specifications

Product Name Alternative

CALC, EFHA3, MPXPS, CBARA1, ara CALC

UniProt

Q9BPX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICU1 Rabbit Polyclonal Antibody (orb589465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001182447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS4 Antibody (Center) Blocking peptide
MBS9218674-01 0.5 mg

SOCS4 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
SOCS4 Antibody (Center) Blocking peptide
MBS9218674-02 5x 0.5 mg

SOCS4 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
Human ACO-2 (Aconitase 2) ValidElisa Kit
EK341698 96 Well

Human ACO-2 (Aconitase 2) ValidElisa Kit

Sign In for Pricing
View Details
SP-10/ACRV1 Protein, Human, Recombinant (His Tag)
MBS8120971-01 0.1 mg

SP-10/ACRV1 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
SP-10/ACRV1 Protein, Human, Recombinant (His Tag)
MBS8120971-02 5x 0.1 mg

SP-10/ACRV1 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Monkey Integrin alpha 2b ELISA Kit
MBS7271951-01 48 Well

Monkey Integrin alpha 2b ELISA Kit

Sign In for Pricing
View Details