Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICU1 Peptide - middle region

MICU1 Peptide - middle region

Product Specifications

Product Name Alternative

CALC, EFHA3, MPXPS, CBARA1, ara CALC

UniProt

Q9BPX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICU1 Rabbit Polyclonal Antibody (orb589465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001182447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A3 Mouse mAb
orb2714284-01 50 µL

BTN3A3 Mouse mAb

Sign In for Pricing
View Details
BTN3A3 Mouse mAb
orb2714284-02 100 µL

BTN3A3 Mouse mAb

Sign In for Pricing
View Details
Monkey Sorting Nexin 7 (SNX7) ELISA Kit
MBS9394088-01 48 Well

Monkey Sorting Nexin 7 (SNX7) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 7 (SNX7) ELISA Kit
MBS9394088-02 96 Well

Monkey Sorting Nexin 7 (SNX7) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 7 (SNX7) ELISA Kit
MBS9394088-03 5x 96 Well

Monkey Sorting Nexin 7 (SNX7) ELISA Kit

Sign In for Pricing
View Details
Monkey Sorting Nexin 7 (SNX7) ELISA Kit
MBS9394088-04 10x 96 Well

Monkey Sorting Nexin 7 (SNX7) ELISA Kit

Sign In for Pricing
View Details