Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRTP1 Peptide - N-terminal region

GRTP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TBC1D6

UniProt

Q5TC63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRTP1 Rabbit Polyclonal Antibody (orb589466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001273661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SURF2 Antibody
OC-699-01 50 μL

SURF2 Antibody

Sign In for Pricing
View Details
SURF2 Antibody
OC-699-02 100 µL

SURF2 Antibody

Sign In for Pricing
View Details
SURF2 Antibody
OC-699-03 1 mL

SURF2 Antibody

Sign In for Pricing
View Details
UBE2I Human Gene Knockout Kit (CRISPR)
KN201199LP 1 Kit

UBE2I Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-NED azide
217-AAT 1 mg

6-NED azide

Sign In for Pricing
View Details
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: 8G3]
AM06459SU-N 100 µL

Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: 8G3]

Sign In for Pricing
View Details