Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRTP1 Peptide - N-terminal region

GRTP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TBC1D6

UniProt

Q5TC63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRTP1 Rabbit Polyclonal Antibody (orb589466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001273661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]
TA808338AM 100 µL

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]

Sign In for Pricing
View Details
NTA Azide
12605-AAT 1 mg

NTA Azide

Sign In for Pricing
View Details
IMPDH1 (NM_000883) Human Over-expression Lysate
LC400315 20 µg

IMPDH1 (NM_000883) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987C-01 50 Tests

FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987C-02 100 Tests

FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987C-03 2x 100 Tests

FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details