Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA5 Peptide - N-terminal region

APOA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAP3, APOAV

UniProt

Q6Q788

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOA5 Rabbit Polyclonal Antibody (orb589468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001160070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1560958 siRNA Oligos set (Rat)
39234176 3x 5 nmol

RGD1560958 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SnoN (SKIL) Mouse Monoclonal Antibody [Clone ID: LBI2C9]
AMM14421V 100 µL

SnoN (SKIL) Mouse Monoclonal Antibody [Clone ID: LBI2C9]

Sign In for Pricing
View Details
HIRIP3 (D-10) : m-IgG Fc BP-HRP Bundle
sc-529938 1 Kit

HIRIP3 (D-10) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Proline--tRNA ligase (proS), partial
MBS1004296 Inquire

Recombinant Pelobacter propionicus Proline--tRNA ligase (proS), partial

Sign In for Pricing
View Details
IpaH7.8 Antibody
orb819415 2 mg

IpaH7.8 Antibody

Sign In for Pricing
View Details
Monkey Olfactory receptor 1N2 (OR1N2) ELISA Kit
MBS7216329-01 48 Well

Monkey Olfactory receptor 1N2 (OR1N2) ELISA Kit

Sign In for Pricing
View Details