Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA5 Peptide - N-terminal region

APOA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAP3, APOAV

UniProt

Q6Q788

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOA5 Rabbit Polyclonal Antibody (orb589468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001160070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4645208 1.0 µg DNA

Vmn2r90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Research Grade Ichorcumab
HF621016-01 100 µg

Research Grade Ichorcumab

Sign In for Pricing
View Details
Research Grade Ichorcumab
HF621016-02 1 mg

Research Grade Ichorcumab

Sign In for Pricing
View Details
COX16 siRNA (Human)
orb1858630-01 15 nmol

COX16 siRNA (Human)

Sign In for Pricing
View Details
COX16 siRNA (Human)
orb1858630-02 30 nmol

COX16 siRNA (Human)

Sign In for Pricing
View Details
Itpr3 Mouse shRNA Plasmid (Locus ID 16440)
TL501130 1 Kit

Itpr3 Mouse shRNA Plasmid (Locus ID 16440)

Sign In for Pricing
View Details