Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDC2 Peptide - C-terminal region

SDC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSPG, CD362, HSPG1, SYND2

UniProt

E7ESK6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDC2 Rabbit Polyclonal Antibody (orb589469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002989.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Basic (KRT, Type II, HMW) (BSA & Azide Free) (MaxLight 750)
MBS6236677-01 0.1 mL

Cytokeratin, Basic (KRT, Type II, HMW) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Cytokeratin, Basic (KRT, Type II, HMW) (BSA & Azide Free) (MaxLight 750)
MBS6236677-02 5x 0.1 mL

Cytokeratin, Basic (KRT, Type II, HMW) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
MAVS Rabbit Polyclonal Antibody
E53P10389 100 µL

MAVS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GNAI3 Antibody
NBP2-82235-0.1mL 0.1 mL

Rabbit Polyclonal GNAI3 Antibody

Sign In for Pricing
View Details
Anti-Human SNCA/Alpha-synuclein Antibody (D10), APC
HW755137-01 1 Each

Anti-Human SNCA/Alpha-synuclein Antibody (D10), APC

Sign In for Pricing
View Details
Anti-Human SNCA/Alpha-synuclein Antibody (D10), APC
HW755137-02 100 Tests

Anti-Human SNCA/Alpha-synuclein Antibody (D10), APC

Sign In for Pricing
View Details