INTS13 Peptide - middle region
INTS13 Peptide - middle region
Product Specifications
Product Name Alternative
ASUN, GCT1, NET48, Mat89Bb, SPATA30, C12orf11
UniProt
Q9NVM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS13 Rabbit Polyclonal Antibody (orb55808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060634.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
