Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS13 Peptide - middle region

INTS13 Peptide - middle region

Product Specifications

Product Name Alternative

ASUN, GCT1, NET48, Mat89Bb, SPATA30, C12orf11

UniProt

Q9NVM9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS13 Rabbit Polyclonal Antibody (orb55808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060634.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHC1 Polyclonal Antibody
MBS9126605-01 0.02 mL

PHC1 Polyclonal Antibody

Sign In for Pricing
View Details
PHC1 Polyclonal Antibody
MBS9126605-02 0.1 mL

PHC1 Polyclonal Antibody

Sign In for Pricing
View Details
PHC1 Polyclonal Antibody
MBS9126605-03 5x 0.1 mL

PHC1 Polyclonal Antibody

Sign In for Pricing
View Details
Mageb3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4867302 1.0 µg DNA

Mageb3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Tryptase
AP88416-01 50 µg

Tryptase

Sign In for Pricing
View Details
Tryptase
AP88416-02 100 µg

Tryptase

Sign In for Pricing
View Details