APOBEC3A Peptide - middle region
APOBEC3A Peptide - middle region
Product Specifications
UniProt
P31941
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APOBEC3A Rabbit Polyclonal Antibody (orb589470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001180218.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15373574 1 Vial
Lentiviral human SWAP70 sgRNA gene knockout kit - Lentiviral human SWAP70 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
MBS1482772-01 0.02 mg (E-Coli)
Recombinant Mesorhizobium sp. Protein RecA (recA)
Sign In for Pricing
View Details MBS1482772-02 0.02 mg (Yeast)
Recombinant Mesorhizobium sp. Protein RecA (recA)
Sign In for Pricing
View Details MBS1482772-03 0.1 mg (E-Coli)
Recombinant Mesorhizobium sp. Protein RecA (recA)
Sign In for Pricing
View Details MBS1482772-04 0.1 mg (Yeast)
Recombinant Mesorhizobium sp. Protein RecA (recA)
Sign In for Pricing
View Details