Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3A Peptide - middle region

APOBEC3A Peptide - middle region

Product Specifications

UniProt

P31941

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3A Rabbit Polyclonal Antibody (orb589470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001180218.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GSTA2 Antibody
MBS8245710-01 0.03 mL

Anti-GSTA2 Antibody

Sign In for Pricing
View Details
Anti-GSTA2 Antibody
MBS8245710-02 0.05 mL

Anti-GSTA2 Antibody

Sign In for Pricing
View Details
Anti-GSTA2 Antibody
MBS8245710-03 0.1 mL

Anti-GSTA2 Antibody

Sign In for Pricing
View Details
Anti-GSTA2 Antibody
MBS8245710-04 0.2 mL

Anti-GSTA2 Antibody

Sign In for Pricing
View Details
Anti-GSTA2 Antibody
MBS8245710-05 5x 0.2 mL

Anti-GSTA2 Antibody

Sign In for Pricing
View Details
Dmc1 (h2) : 293T Lysate
sc-128470 100 µg - 200 µL

Dmc1 (h2) : 293T Lysate

Sign In for Pricing
View Details