CEP97 Peptide - middle region
CEP97 Peptide - middle region
Product Specifications
Product Name Alternative
LRRIQ2, 2810403B08Rik
UniProt
Q8IW35
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEP97 Rabbit Polyclonal Antibody (orb589471) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001290330.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVELRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2575149-01 0.06 mL
(KD Validated) RHOT1/MIRO1 Polyclonal Antibody
Sign In for Pricing
View Details MBS2575149-02 0.12 mL
(KD Validated) RHOT1/MIRO1 Polyclonal Antibody
Sign In for Pricing
View Details MBS2575149-03 0.2 mL
(KD Validated) RHOT1/MIRO1 Polyclonal Antibody
Sign In for Pricing
View Details MBS2575149-04 5x 0.2 mL
(KD Validated) RHOT1/MIRO1 Polyclonal Antibody
Sign In for Pricing
View Details 
