INPP1 Peptide - middle region
INPP1 Peptide - middle region
Product Specifications
UniProt
P49441
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INPP1 Rabbit Polyclonal Antibody (orb589473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001122400.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAF
More Discoveries
Explore Other Products
Browse additional items from our catalog
36310121 3x 1.0µg DNA
PDHB CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
PB9096-Dylight594 100 µg
Anti-CD45/PTPRC Antibody Picoband® (Dylight594 Conjugate)
Sign In for Pricing
View Details