INPP1 Peptide - middle region
INPP1 Peptide - middle region
Product Specifications
UniProt
P49441
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INPP1 Rabbit Polyclonal Antibody (orb589473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001122400.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAF
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP65891_P050-FITC 100 µL
FOLR2 Antibody - C-terminal region : FITC (ARP65891_P050-FITC)
Sign In for Pricing
View Details 
NBP2-82025AF594 0.1 mL
Rabbit Polyclonal PRR5L Antibody [Alexa Fluor 594]
Sign In for Pricing
View Details