Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL3 Peptide - middle region

RASAL3 Peptide - middle region

Product Specifications

UniProt

Q86YV0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASAL3 Rabbit Polyclonal Antibody (orb589478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_075055.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKPGFLAPRDLPKHTPLISKSQSLRSVRRSESWARPRPDEERPLRRPRPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Equine IL-2 (Cys141Ser)
1613-IL-020 20 µg

Recombinant Equine IL-2 (Cys141Ser)

Sign In for Pricing
View Details
Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)
VG2C88-01 1 mg

Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)

Sign In for Pricing
View Details
Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)
VG2C88-02 100 µg

Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)

Sign In for Pricing
View Details
Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)
VG2C88-03 20 µg

Recombinant Canine Coronavirus Envelope Small Membrane Protein (E)

Sign In for Pricing
View Details
SLx-2119
A3825-10 10 mg

SLx-2119

Sign In for Pricing
View Details
Human ANG-2 Recombinant Protein Lyophilized 5UG
IHUANG2RLY5UG 5 µg

Human ANG-2 Recombinant Protein Lyophilized 5UG

Sign In for Pricing
View Details