RASAL3 Peptide - middle region
RASAL3 Peptide - middle region
Product Specifications
UniProt
Q86YV0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASAL3 Rabbit Polyclonal Antibody (orb589478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_075055.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKPGFLAPRDLPKHTPLISKSQSLRSVRRSESWARPRPDEERPLRRPRPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1240705-01 0.02 mg (E-Coli)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details MBS1240705-02 0.02 mg (Yeast)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details MBS1240705-03 0.1 mg (E-Coli)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details MBS1240705-04 0.1 mg (Yeast)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details MBS1240705-05 0.02 mg (Baculovirus)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details MBS1240705-06 0.02 mg (Mammalian-Cell)
Recombinant Mycobacterium bovis o-succinylbenzoate synthase (menC)
Sign In for Pricing
View Details