Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF Peptide - C-terminal region

CTSF Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATSF, CLN13

UniProt

Q9UBX1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSF Rabbit Polyclonal Antibody (orb589299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003784.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear GFP-Luciferase lentivirus (CMV, Puro) - nuclear GFP-Luciferase lentivirus (CMV, Puro) -10ug
GTR15424859 10 µg

Nuclear GFP-Luciferase lentivirus (CMV, Puro) - nuclear GFP-Luciferase lentivirus (CMV, Puro) -10ug

Sign In for Pricing
View Details
PTPRZ1 Antibody
CSB-PA003884-01 50 µg

PTPRZ1 Antibody

Sign In for Pricing
View Details
PTPRZ1 Antibody
CSB-PA003884-02 100 µg

PTPRZ1 Antibody

Sign In for Pricing
View Details
SARNP Antibody
orb1556689-01 50 μL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
orb1556689-02 100 µL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
orb1556689-03 200 µL

SARNP Antibody

Sign In for Pricing
View Details