Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF Peptide - C-terminal region

CTSF Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATSF, CLN13

UniProt

Q9UBX1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSF Rabbit Polyclonal Antibody (orb589299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003784.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD30 Antibody
MBS8247699-01 0.03 mL

Anti-CD30 Antibody

Sign In for Pricing
View Details
Anti-CD30 Antibody
MBS8247699-02 0.05 mL

Anti-CD30 Antibody

Sign In for Pricing
View Details
Anti-CD30 Antibody
MBS8247699-03 0.1 mL

Anti-CD30 Antibody

Sign In for Pricing
View Details
Anti-CD30 Antibody
MBS8247699-04 0.2 mL

Anti-CD30 Antibody

Sign In for Pricing
View Details
Anti-CD30 Antibody
MBS8247699-05 5x 0.2 mL

Anti-CD30 Antibody

Sign In for Pricing
View Details
Atg16l1 3'UTR GFP Stable Cell Line
TU152265 1.0 mL

Atg16l1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details