NAT8 Peptide - middle region
NAT8 Peptide - middle region
Product Specifications
Product Name Alternative
GLA, CML1, CCNAT, Hcml1, ATase2, TSC501, TSC510
UniProt
Q9UHE5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NAT8 Rabbit Polyclonal Antibody (orb589328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003951.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMA
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Cr0484-500gEcoli 500 µg (E. coli)
Recombinant Pseudomonas Aeruginosa fadA Protein (aa 1-391)
Sign In for Pricing
View Details 
orb2550663 100 µL
Duck Hepatitis Virus VP1 Rabbit Polyclonal Antibody (BF488)
Sign In for Pricing
View Details