Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT8 Peptide - middle region

NAT8 Peptide - middle region

Product Specifications

Product Name Alternative

GLA, CML1, CCNAT, Hcml1, ATase2, TSC501, TSC510

UniProt

Q9UHE5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT8 Rabbit Polyclonal Antibody (orb589328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003951.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dunnianol
MBS5760330 Inquire

Dunnianol

Sign In for Pricing
View Details
Human Glutathione Synthetase (GSS) ELISA Kit
EK14382 48 Tests

Human Glutathione Synthetase (GSS) ELISA Kit

Sign In for Pricing
View Details
STX10 Rabbit pAb
MBS8537792-01 0.1 mL

STX10 Rabbit pAb

Sign In for Pricing
View Details
STX10 Rabbit pAb
MBS8537792-02 0.1 mL (AF405L)

STX10 Rabbit pAb

Sign In for Pricing
View Details
STX10 Rabbit pAb
MBS8537792-03 0.1 mL (AF405S)

STX10 Rabbit pAb

Sign In for Pricing
View Details
STX10 Rabbit pAb
MBS8537792-04 0.1 mL (AF610)

STX10 Rabbit pAb

Sign In for Pricing
View Details