Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB3A Peptide - N-terminal region

MOB3A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOB1C, moblak, MOB-LAK, MOBKL2A

UniProt

Q96BX8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB3A Rabbit Polyclonal Antibody (orb589343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_570719.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin inhibitor 45
HY-162593 1 Each

Tubulin inhibitor 45

Sign In for Pricing
View Details
NSUN7 Rabbit Polyclonal Antibody
orb2657629 100 µg

NSUN7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C/EBP beta
308546-01 50 µg

C/EBP beta

Sign In for Pricing
View Details
C/EBP beta
308546-02 100 µg

C/EBP beta

Sign In for Pricing
View Details
HIF1 alpha Mouse mAb
MBS9611966-01 0.05 mL

HIF1 alpha Mouse mAb

Sign In for Pricing
View Details
HIF1 alpha Mouse mAb
MBS9611966-02 0.1 mL

HIF1 alpha Mouse mAb

Sign In for Pricing
View Details