MYL1 Peptide - N-terminal region
MYL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MLC1F, MLC3F
UniProt
P05976
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYL1 Rabbit Polyclonal Antibody (orb589377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_524144.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CD3-S52H3-100ug 100 µg
Sus scrofa CD73 / NT5E Protein, His Tag (active enzyme, MALS verified)
Sign In for Pricing
View Details 
LY420054 100 µg
Cyclin H (CCNH) (NM_001239) Human Over-expression Lysate
Sign In for Pricing
View Details 
