Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL1 Peptide - N-terminal region

MYL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLC1F, MLC3F

UniProt

P05976

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYL1 Rabbit Polyclonal Antibody (orb589377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_524144.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Tabersonine
TRC-T003900-10MG 10 mg

(-)-Tabersonine

Sign In for Pricing
View Details
Toldimfos Sodium
TRC-T535270-1G 1 g

Toldimfos Sodium

Sign In for Pricing
View Details
DiOC2 (3) iodide [3,3-Diethyloxacarbocyanine iodide]
22038-AAT 25 mg

DiOC2 (3) iodide [3,3-Diethyloxacarbocyanine iodide]

Sign In for Pricing
View Details
Tris(3,5-di-tert-butyl-4-hydroxybenzyl) Isocyanurate
TRC-T875200-1G 1 g

Tris(3,5-di-tert-butyl-4-hydroxybenzyl) Isocyanurate

Sign In for Pricing
View Details
Storage Box
R1020-B 5 Units/Pack

Storage Box

Sign In for Pricing
View Details
Syntaxin 4 (STX4) Human Gene Knockout Kit (CRISPR)
KN400347 1 Kit

Syntaxin 4 (STX4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details