Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDMD Peptide - middle region

GSDMD Peptide - middle region

Product Specifications

Product Name Alternative

DF5L, DFNA5L, FKSG10, GSDMDC1

UniProt

P57764

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDMD Rabbit Polyclonal Antibody (orb589380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001159709.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-378c miRNA Inhibitor
MBS8296590-01 10 nmol

mmu-miR-378c miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-378c miRNA Inhibitor
MBS8296590-02 20 nmol

mmu-miR-378c miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-378c miRNA Inhibitor
MBS8296590-03 5x 20 nmol

mmu-miR-378c miRNA Inhibitor

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2082558-01 0.1 mL

PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2082558-02 0.2 mL

PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2082558-03 0.5 mL

PE-Linked Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details