Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDMD Peptide - middle region

GSDMD Peptide - middle region

Product Specifications

Product Name Alternative

DF5L, DFNA5L, FKSG10, GSDMDC1

UniProt

P57764

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDMD Rabbit Polyclonal Antibody (orb589380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001159709.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immunoglobulin A (IgA) Chicken ELISA Kit
E2303 96 Tests

Immunoglobulin A (IgA) Chicken ELISA Kit

Sign In for Pricing
View Details
Cog8 ORF Vector (Mouse) (pORF)
ORF041750 1.0 µg DNA

Cog8 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
DGAT2 Polyclonal Antibody
RA31970-01 50 µL

DGAT2 Polyclonal Antibody

Sign In for Pricing
View Details
DGAT2 Polyclonal Antibody
RA31970-02 100 µL

DGAT2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human XRN2 Protein, N-His
orb2965197-01 50 µg

Recombinant Human XRN2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human XRN2 Protein, N-His
orb2965197-02 100 µg

Recombinant Human XRN2 Protein, N-His

Sign In for Pricing
View Details