Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYKPL Peptide - middle region

PHYKPL Peptide - middle region

Product Specifications

Product Name Alternative

PHLU, AGXT2L2

UniProt

Q8IUZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHYKPL Rabbit Polyclonal Antibody (orb589384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265275.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WVHVAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGRKIAAFFAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-3-nitro-Tyr-OH
B-2690.0001 1.0g

Fmoc-3-nitro-Tyr-OH

Sign In for Pricing
View Details
Placental lactogen I+II Rabbit pAb
orb2711112-01 50 µL

Placental lactogen I+II Rabbit pAb

Sign In for Pricing
View Details
Placental lactogen I+II Rabbit pAb
orb2711112-02 100 µL

Placental lactogen I+II Rabbit pAb

Sign In for Pricing
View Details
HDAC3 Antibody [J15M12]
F4029-20uL 20 µL

HDAC3 Antibody [J15M12]

Sign In for Pricing
View Details
2- (Aminooxy) ethanol
FA58724-01 500 mg

2- (Aminooxy) ethanol

Sign In for Pricing
View Details
2- (Aminooxy) ethanol
FA58724-02 1000 mg

2- (Aminooxy) ethanol

Sign In for Pricing
View Details