PHYKPL Peptide - middle region
PHYKPL Peptide - middle region
Product Specifications
Product Name Alternative
PHLU, AGXT2L2
UniProt
Q8IUZ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PHYKPL Rabbit Polyclonal Antibody (orb589384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001265275.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WVHVAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGRKIAAFFAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1949041-01 48 Tests
Human Mothers Against Decapentaplegic Homolog 3 (Smad3/MADH3) ELISA Kit
Sign In for Pricing
View Details orb1949041-02 96 Tests
Human Mothers Against Decapentaplegic Homolog 3 (Smad3/MADH3) ELISA Kit
Sign In for Pricing
View Details 
A00667-1-iFluor647 100 µg
Anti-Thrombospondin/THBS1 Antibody Picoband® (iFluor647 Conjugate)
Sign In for Pricing
View Details