Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOC2B Peptide - middle region

DOC2B Peptide - middle region

Product Specifications

Product Name Alternative

DOC2BL

UniProt

Q14184

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOC2B Rabbit Polyclonal Antibody (orb589385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003576.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cathepsin E ELISA Kit
MBS8244629-01 96 Tests

Human Cathepsin E ELISA Kit

Sign In for Pricing
View Details
Human Cathepsin E ELISA Kit
MBS8244629-02 5x 96 Tests

Human Cathepsin E ELISA Kit

Sign In for Pricing
View Details
CD197/CCR7 Mouse Monoclonal Antibody
orb2975230-01 50 µg

CD197/CCR7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD197/CCR7 Mouse Monoclonal Antibody
orb2975230-02 100 µg

CD197/CCR7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-STMN1 (Ser63) Rabbit Polyclonal Antibody (BF405)
orb1606376 100 µL

Phospho-STMN1 (Ser63) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rat Survivin ELISA Kit
MBS728167-01 48 Well

Rat Survivin ELISA Kit

Sign In for Pricing
View Details