DOC2B Peptide - middle region
DOC2B Peptide - middle region
Product Specifications
Product Name Alternative
DOC2BL
UniProt
Q14184
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DOC2B Rabbit Polyclonal Antibody (orb589385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003576.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P9003-01F-Biotin 200 µL
PRKDC, ID (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (Biotin) discontinued
Sign In for Pricing
View Details 
MBS6490918-01 0.2 mL
OASIS, CT (Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, cAMP-responsive Element-binding Protein 3-like Protein 1, Old Astrocyte Specifically-induced Substance, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, CR
Sign In for Pricing
View Details