TIMMDC1 Peptide - middle region
TIMMDC1 Peptide - middle region
Product Specifications
Product Name Alternative
C3orf1
UniProt
Q9NPL8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TIMMDC1 Rabbit Polyclonal Antibody (orb55800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057673.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDE
More Discoveries
Explore Other Products
Browse additional items from our catalog
129820-HRP 100 µL
MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (HRP)
Sign In for Pricing
View Details MR219722L3V 200 µL
1700031F05Rik (NM_028496) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
RC402280 10 µg
G protein alpha S (GNAS) (NM_000516) Human Mutant ORF Clone
Sign In for Pricing
View Details