TIMMDC1 Peptide - middle region
TIMMDC1 Peptide - middle region
Product Specifications
Product Name Alternative
C3orf1
UniProt
Q9NPL8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TIMMDC1 Rabbit Polyclonal Antibody (orb55800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057673.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDE
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Alexa Fluor 488]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP3-20720AF488 0.1 mL
Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Alexa Fluor 488]
Sign In for Pricing
View Details 
RC222819L2 10 µg
MCK10 (DDR1) (NM_013994) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
LV635405 1.0 µg DNA
SLC16A11 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details 