NCR3 Peptide - middle region
NCR3 Peptide - middle region
Product Specifications
Product Name Alternative
1C7, MALS, CD337, LY117, NKp30
UniProt
O14931
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NCR3 Rabbit Polyclonal Antibody (orb589392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001138938.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15380661 1 Vial
Lentiviral human ZC3H4 sgRNA gene knockout kit - Lentiviral human ZC3H4 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details H-053-42 50 μL
Catestatin / prepro-Chromogranin A (385-405) (Mouse) - Antibody
Sign In for Pricing
View Details