HPX Peptide - middle region
HPX Peptide - middle region
Product Specifications
Product Name Alternative
HX
UniProt
P02790
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HPX Rabbit Polyclonal Antibody (orb589397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000604.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7032803-01 0.02 mg
Recombinant Rat UDP-glucuronosyltransferase 1-6 (Ugt1)
Sign In for Pricing
View Details MBS7032803-02 0.1 mg
Recombinant Rat UDP-glucuronosyltransferase 1-6 (Ugt1)
Sign In for Pricing
View Details MBS7032803-03 5x 0.1 mg
Recombinant Rat UDP-glucuronosyltransferase 1-6 (Ugt1)
Sign In for Pricing
View Details 
HY-W747573 5 mg (155.52 mM x 100 μL in Ethanol)
N-Linolenoylethanolamine
Sign In for Pricing
View Details