Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPX Peptide - middle region

HPX Peptide - middle region

Product Specifications

Product Name Alternative

HX

UniProt

P02790

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPX Rabbit Polyclonal Antibody (orb589397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000604.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Dimethoxymethyl) pyridine-5-boronic acid, pinacol ester
AWB63293 2.5 g

2- (Dimethoxymethyl) pyridine-5-boronic acid, pinacol ester

Sign In for Pricing
View Details
NP Antibody
orb863982 2 mg

NP Antibody

Sign In for Pricing
View Details
Recombinant Human SEPTIN8
MBS7616076-01 0.05 mg

Recombinant Human SEPTIN8

Sign In for Pricing
View Details
Recombinant Human SEPTIN8
MBS7616076-02 0.2 mg

Recombinant Human SEPTIN8

Sign In for Pricing
View Details
Recombinant Human SEPTIN8
MBS7616076-03 1 mg

Recombinant Human SEPTIN8

Sign In for Pricing
View Details
Recombinant Human SEPTIN8
MBS7616076-04 5x 1 mg

Recombinant Human SEPTIN8

Sign In for Pricing
View Details