Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBRS Peptide - middle region

FBRS Peptide - middle region

Product Specifications

Product Name Alternative

FBS, FBS1

UniProt

Q9HAH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBRS Rabbit Polyclonal Antibody (orb55801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001098549.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSDKERPVERREPSITKEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNQP1 Human Gene Knockout Kit (CRISPR)
KN425327 1 Kit

CCNQP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS507205 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
Eslicarbazepine Acetate
TRC-E659000-500MG 500 mg

Eslicarbazepine Acetate

Sign In for Pricing
View Details
NextPette™ variable volume pipette 0.5 to 10ul
P7700-10 1 Each

NextPette™ variable volume pipette 0.5 to 10ul

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), Biotin conjugate, 0.1mg/mL
BNCB2314-500 1x 500 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LETM2 activation kit by CRISPRa
GA115295 1 Kit

Human LETM2 activation kit by CRISPRa

Sign In for Pricing
View Details