Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBRS Peptide - middle region

FBRS Peptide - middle region

Product Specifications

Product Name Alternative

FBS, FBS1

UniProt

Q9HAH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBRS Rabbit Polyclonal Antibody (orb55801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001098549.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSDKERPVERREPSITKEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Desacetyl-6-bromo-N-Boc Palbociclib-d4
TRC-D445874-25MG 25 mg

6-Desacetyl-6-bromo-N-Boc Palbociclib-d4

Sign In for Pricing
View Details
Recombinant Human CD79B/B29 Protein (His Tag)
PKSH032224-01 10 µg

Recombinant Human CD79B/B29 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD79B/B29 Protein (His Tag)
PKSH032224-02 50 µg

Recombinant Human CD79B/B29 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant MCJ Antibody
RC-15383-01 50 μL

Recombinant MCJ Antibody

Sign In for Pricing
View Details
Recombinant MCJ Antibody
RC-15383-02 100 µL

Recombinant MCJ Antibody

Sign In for Pricing
View Details
Recombinant MCJ Antibody
RC-15383-03 1 mL

Recombinant MCJ Antibody

Sign In for Pricing
View Details