CYP27B1 Peptide - C-terminal region
CYP27B1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
VDR, CP2B, CYP1, PDDR, VDD1, VDDR, VDDRI, CYP27B, P450c1, CYP1alpha
UniProt
O15528
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYP27B1 Rabbit Polyclonal Antibody (orb589401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000776.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
