Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB1M Peptide - C-terminal region

TFB1M Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI75, mtTFB, CGI-75, mtTFB1

UniProt

Q8WVM0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFB1M Rabbit Polyclonal Antibody (orb588373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057104.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SISHFKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphA7 (E-7) PE
sc-393973 PE 200 µg/mL

EphA7 (E-7) PE

Sign In for Pricing
View Details
Rabbit Polyclonal CNKSR1 Antibody [DyLight 488]
NBP2-97250G 0.1 mL

Rabbit Polyclonal CNKSR1 Antibody [DyLight 488]

Sign In for Pricing
View Details
MIR4701 Human MicroRNA Expression Plasmid (MI0017334)
SC401845 10 µg

MIR4701 Human MicroRNA Expression Plasmid (MI0017334)

Sign In for Pricing
View Details
MI-136 10mM * 1mL in DMSO
A16615-10mM-D 10 mM x 1mL in DMSO

MI-136 10mM * 1mL in DMSO

Sign In for Pricing
View Details
KRTAP12-4 Lentiviral Activation Particles (h2)
sc-415734-LAC-2 200 µL

KRTAP12-4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Parimifasor
M12714-01 1 g

Parimifasor

Sign In for Pricing
View Details